NB300-701 E2F1 Transcription Factor antibody
see related secondary antibodiessee all 43 E2F1 Transcription Factor products
0.1 mg / US$ 525 no delivery possible
Quick Overview
Rabbit anti E2F1 Transcription Factor
Synonyms
E2F-1, RBBP3, RBBP-3, PBR3, RBAP-1, RBAP1, , Retinoblastoma-binding protein 3, PRB-binding protein E2F-1, Retinoblastoma-associated protein 1
Product review
Please read our product review about E2F1 Transcription Factor: Antibodies to E2F Transcription Factor Family.
Product Description
Rabbit anti E2F1 Transcription Factor , Presentation: Aff - Purified. Product is tested for Frozen sections ( C ), Immunoprecipitation ( IP ), Western blot / Immunoblot ( WB )
Properties
| Applications | Frozen sections ( C ), Immunoprecipitation ( IP ), Western blot / Immunoblot ( WB ) |
| Reactivity | Human ( Hu ) |
| Presentation | Aff - Purified |
| Host | Rabbit |
| Catalog Number | NB300-701 |
| Swiss Prot. No. | Q01094 |
| Quantity | 0.1 mg |
| Price | US$ 525 no delivery possible |
| Delivery | Not USA/Canada |
| Manufacturer | Novus Biologicals Inc. |
| Datasheet | http://www.novusbio.com/p ... |
Datasheet Extract
| Rabbit Polyclonal anti-E2F1 | |
| Concentration | 1 mg/ml |
| Immunogen | Synthetic peptide: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD, corresponding to amino acids 58-93 of Human E2F1. Swiss Num.: Q01094 |
| Format | Purification: Immunogen affinity purified Purity: Immunogen affinity purified |
| Applications | immunohistochemistry, immunoprecipitation, Western Blot |
| Specificity | Species: Cross-reacts with Human. Not yet tested in other species. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze thaw cycles. |
| References | General / background references:Iglesias A et al. Diabetes and exocrine pancreatic insufficiency in E2F1/E2F2 double-mutant mice. J Clin Invest 113:1398-407 (2004). |
12 Secondary Antibodies
| Catalog No. | Name / Host | Presentation | Reactivity | ||||
|---|---|---|---|---|---|---|---|
| R1364B | Rabbit IgG (H&L) | ||||||
| Goat | Biotin | 2 mg / US$ 295 | |||||
| R1364F | Rabbit IgG (H&L) | ||||||
| Goat | FITC | 2 mg / US$ 285 | |||||
| R1364T | Rabbit IgG (H&L) | ||||||
| Goat | TRITC | 2 mg / US$ 285 | |||||
| R1364TR | Rabbit IgG (H&L) | ||||||
| Goat | Texas Red | 2 mg / US$ 295 | |||||
| R1364HRP | Rabbit IgG (H&L) | ||||||
| Goat | HRP | 2 mg / US$ 295 | |||||
| R1364AP | Rabbit IgG (H&L) | ||||||
| Goat | AP | 1 mg / US$ 325 | |||||
| R1458C2 | Rabbit IgG (H&L) multi-species ads. | ||||||
| Goat | Cy2 | 1 mg / US$ 445 | |||||
| R1458C3 | Rabbit IgG (H&L) multi-species ads. | ||||||
| Goat | Cy3 | 1 mg / US$ 445 | |||||
| R1458C35 | Rabbit IgG (H&L) multi-species ads. | ||||||
| Goat | Cy3.5 | 1 mg / US$ 445 | |||||
| R1458C5 | Rabbit IgG (H&L) multi-species ads. | ||||||
| Goat | Cy5 | 1 mg / US$ 445 | |||||
| R1458C55 | Rabbit IgG (H&L) multi-species ads. | ||||||
| Goat | Cy5.5 | 1 mg / US$ 445 | |||||
| R1427R | Rabbit IgG (H&L) F(ab')2 Fragment multi-species ads. | ||||||
| Donkey | PE | 1 ml / US$ 455 | |||||
Click here to see all secondary antibodies for 'NB300-701 E2F1 Transcription Factor'.

