NB110-57131 ABCC1 / MRP1 antibody
see related secondary antibodiessee all 23 ABCC1 / MRP1 products
0.1 ml / US$ 435 no delivery possible
Quick Overview
Mouse anti ABCC1 / MRP1 IU5C1
Synonyms
Multidrug resistance-associated protein 1, LTC4 transporter, ATP-binding cassette sub-family C member 1, Leukotriene C(4) transporter
Product Description
Mouse anti ABCC1 / MRP1 IU5C1, Presentation: Aff - Purified. Product is tested for Western blot / Immunoblot ( WB )
Properties
| Applications | Western blot / Immunoblot ( WB ) |
| Reactivity | Human ( Hu ), Mouse ( Ms ) |
| Presentation | Aff - Purified |
| Host | Mouse |
| Isotype | IgG1 |
| Clone | IU5C1 |
| Catalog Number | NB110-57131 |
| Swiss Prot. No. | P33527 |
| Quantity | 0.1 ml |
| Price | US$ 435 no delivery possible |
| Delivery | Not USA/Canada |
| Manufacturer | Novus Biologicals Inc. |
| Datasheet |  http://www.novusbio.com/d ... |
Datasheet Extract
| Mouse Monoclonal anti-MRP-1 (IU5C1) | |
| Alternate names | anti-ABC29 antibody, ABCC antibody, ABCC1 antibody, ATP binding cassette sub-family C member 1 antibody, GSX antibody, MRP antibody, Multidrug resistance associated protein 1 antibody, Multidrug resistance protein antibody, Multiple drug resistance associated protein antibody, Multiple drug resistance protein 1 antibody, Leukotriene C(4) transporter antibody, LTC4 transporter antibody |
| Concentration | 6.8 mg/ml |
| Background | The MRP molecule, an integral membrane glycophosphoprotein belonging to the same superfamily of ATP-binding cassette transmembrane transporter proteins as P-glycoprotein, is overexpressed in many P-glycoprotein-negative, multidrug resistant cell lines and tumours. It is believed that the main function of MRP in drug resistance is that of a plasma membrane drug efflux pump. |
| Immunogen | A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. [Swiss-Prot# P33527] Swiss Num.: P33527 |
| Format | Purification: Ascites Purity: Ascites |
| Applications | immunofluorescence , Western Blot 1:250-1:500 |
| Specificity | Species: This antibody cross-reacts with human and mouse protein. Other species have not been tested. |
| Storage | Store at -20 degrees C long term. |
| References | 1. Chen, Q, et al. JBC. 281: 31152-31163 (2006) |
14 Secondary Antibodies
| Catalog No. | Name / Host | Presentation | Reactivity | ||||
|---|---|---|---|---|---|---|---|
| R1253B | Mouse IgG (H&L) | ||||||
| Rabbit | Biotin | 2 mg / US$ 305 | |||||
| R1253F | Mouse IgG (H&L) | ||||||
| Rabbit | FITC | 2 mg / US$ 285 | |||||
| R1253T | Mouse IgG (H&L) | ||||||
| Rabbit | TRITC | 2 mg / US$ 285 | |||||
| R1253TR | Mouse IgG (H&L) | ||||||
| Rabbit | Texas Red | 2 mg / US$ 295 | |||||
| R1253HRP | Mouse IgG (H&L) | ||||||
| Rabbit | HRP | 2 mg / US$ 315 | |||||
| R1253AP | Mouse IgG (H&L) | ||||||
| Rabbit | AP | 1 mg / US$ 325 | |||||
| R1457C2 | Mouse IgG (H&L) multi-species ads. | ||||||
| Goat | Cy2 | 1 mg / US$ 445 | |||||
| R1457C3 | Mouse IgG (H&L) multi-species ads. | ||||||
| Goat | Cy3 | 1 mg / US$ 445 | |||||
| R1457C35 | Mouse IgG (H&L) multi-species ads. | ||||||
| Goat | Cy3.5 | 1 mg / US$ 445 | |||||
| R1457C5 | Mouse IgG (H&L) multi-species ads. | ||||||
| Goat | Cy5 | 1 mg / US$ 445 | |||||
| R1457C55 | Mouse IgG (H&L) multi-species ads. | ||||||
| Goat | Cy5.5 | 1 mg / US$ 445 | |||||
| R1405R | Mouse IgG (H&L) F(ab')2 Fragment ads. to Bov, Eq, Hu, Rb, Rt, Sh | ||||||
| Goat | PE | 1 ml / US$ 455 | |||||
| R1403R | Mouse IgG (H&L) F(ab')2 Fragment ads. to Hu serum proteins | ||||||
| Rabbit | PE | 1 ml / US$ 455 | |||||
| R1455R | Mouse IgG (H&L) F(ab')2 Fragment multi-species ads. | ||||||
| Donkey | PE | 1 ml / US$ 455 | |||||
Click here to see all secondary antibodies for 'NB110-57131 ABCC1 / MRP1'.
